Product Added to your Cart
x

-------- OR --------

Default
Default
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Mini
18 product(s) found for "Mini"
1x Mini Cooper S R52 Superch..
Mini
1x Mini Cooper S R52 Superch..
1x Mini Cooper S R52 Supercharged Signature Vinyl Decal Car Sticker | Works Size approx 15cm
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
1x Mini Cooper S R52 Supercharged Signature Vinyl Decal Car Sticker | Works Size approx 15cm
1x Mini Cooper S R53 Superch..
Mini
1x Mini Cooper S R53 Superch..
1x Mini Cooper S R53 Supercharged Car Vinyl Decal Badge Sticker GP | JCW Size :: 15cm approx
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
1x Mini Cooper S R53 Supercharged Car Vinyl Decal Badge Sticker GP | JCW Size :: 15cm approx
1x Mini Cooper S R53 Superch..
Mini
1x Mini Cooper S R53 Superch..
1x Mini Cooper S R53 Supercharged Car Vinyl Decal Sticker | JCW | GP | Boost Approx Size 15cm
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
1x Mini Cooper S R53 Supercharged Car Vinyl Decal Sticker | JCW | GP | Boost Approx Size 15cm
1x Mini Cooper S R53 Superch..
Mini
1x Mini Cooper S R53 Superch..
1x Mini Cooper S R53 Supercharged Car Vinyl Decal Sticker | MINI JCW MINI GP ETC size approx 15cm
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
1x Mini Cooper S R53 Supercharged Car Vinyl Decal Sticker | MINI JCW MINI GP ETC size approx 15cm
1x Mini Cooper S R53 Superch..
Mini
1x Mini Cooper S R53 Superch..
1x Mini Cooper S R53 Supercharged Signature Car Vinyl Decal Sticker GP | JCW size approx 15cm
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
1x Mini Cooper S R53 Supercharged Signature Car Vinyl Decal Sticker GP | JCW size approx 15cm
1x Mini Cooper S R53 Superch..
Mini
1x Mini Cooper S R53 Superch..
1x Mini Cooper S R53 Supercharged Signature Car Vinyl Decal Sticker GP | JCW Size Is Approx 15cm
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
1x Mini Cooper S R53 Supercharged Signature Car Vinyl Decal Sticker GP | JCW Size Is Approx 15cm
1x Mini Cooper S R56 Turboch..
Mini
1x Mini Cooper S R56 Turboch..
1x Mini Cooper S R56 Turbocharged Car Vinyl Decal Sticker GP JCW Clubman Size Approx 15cm
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
1x Mini Cooper S R56 Turbocharged Car Vinyl Decal Sticker GP JCW Clubman Size Approx 15cm
2x Mini Cooper S One JCW GP ..
Mini
2x Mini Cooper S One JCW GP ..
2x Mini Cooper S One JCW GP R53 R52 Union Flag Wing Car Vinyl Decal Stickers Sticker size is approximately - Width 9.5cm x Height 5.5cm.
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
2x Mini Cooper S One JCW GP R53 R52 Union Flag Wing Car Vinyl Decal Stickers Sticker size is approximately - Width 9.5cm x Height 5.5cm.
2x Mini Cooper S R53 Superch..
Mini
2x Mini Cooper S R53 Superch..
Mini Cooper S R56 Turbo Car Window Bumper Vinyl Decal Sticker JCW GP AVAILABLE IN VARIOUS COLOUR. Sticker size is approximately - Width 14cm x Height 3.7cm.
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
Mini Cooper S R56 Turbo Car Window Bumper Vinyl Decal Sticker JCW GP AVAILABLE IN VARIOUS COLOUR. Sticker size is approximately - Width 14cm x Height 3.7cm.
2x Mini Cooper S R53 Superch..
Mini
2x Mini Cooper S R53 Superch..
Mini Cooper S R56 Turbo Car Window Bumper Vinyl Decal Sticker JCW GP AVAILABLE IN VARIOUS COLOUR. Sticker size is approximately - Width 14cm x Height 3.7cm.
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
Mini Cooper S R56 Turbo Car Window Bumper Vinyl Decal Sticker JCW GP AVAILABLE IN VARIOUS COLOUR. Sticker size is approximately - Width 14cm x Height 3.7cm.
2x Mini Cooper S Supercharge..
Mini
2x Mini Cooper S Supercharge..
2x Mini Cooper S Supercharged Badge Car Vinyl Decal Sticker | R53 | GP | BMW JCW Sticker size is approximately - Width 12cm x Height 1.5cm.
£5.99
Units in Stock: 0
£5.99
Details
Add To Cart
2x Mini Cooper S Supercharged Badge Car Vinyl Decal Sticker | R53 | GP | BMW JCW Sticker size is approximately - Width 12cm x Height 1.5cm.
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i